The G protein-coupled receptor family, which includes the glucagon receptor (GCGR), is crucial for regulating blood sugar levels. The class B G-protein coupled family of receptors includes the glucagon receptor, a 62 kDa protein that is activated by glucagon and coupled to G alpha i, Gs, and to a lesser extent G alpha q. Adenylate cyclase is activated and intracellular cAMP levels are raised when the receptor is stimulated. The GCGR gene in humans is responsible for encoding the glucagon receptor. The liver and kidneys are the primary sites of glucagon receptor expression, with smaller amounts of these receptors also present in the heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.
Structure | Cat No. | Product Name | CAS No. | Product Description |
---|---|---|---|---|
![]() |
V34009 | GLP-1(7-37) | 106612-94-6 | GLP-1(7-37) [also known as Tglp-1 and Insulinotropin] is a novel and potent insulinotropic hormone generated from the precursor peptide GLP-1 (1-37). |
![]() |
V79600 | GLP-1(9-36)amide TFA | GLP-1(9-36)amide TFA is the major metabolite of glucagon-like peptide-1(7-36)amide. | |
![]() |
V74576 | GLP-1R modulator C16 | 875005-43-9 | GLP-1R modulator C16 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through the transmembrane site (EC50 8.43 ± 3.82 μM). |
![]() |
V74574 | GLP-1R modulator C5 | 421578-93-0 | GLP-1R modulator C5 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through the transmembrane site (EC50 1.59 ± 0.53 μM). |
![]() |
V74577 | GLP-1R modulator L7-028 | 2648317-95-5 | GLP-1R modulator L7-028 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through a transmembrane site (EC50 11.01 ± 2.73 μM). |
![]() |
V74590 | GLP-1Ragonist 17 | 2749609-28-5 | GLP-1R agonist 17 is a GLP-1 receptor agonist. |
![]() |
V74567 | GLP-1Ragonist 2 | 281209-71-0 | GLP-1R agonist 2 (compound 2) is a potent GLP-1R agonist. |
![]() |
V74566 | GLP-2(3-33) | 275801-62-2 | GLP-2(3-33) is generated by dipeptidyl peptidase IV (DPPIV) and is a GLP-2 receptor partial agonist (EC50=5.8 nM). |
![]() |
V16348 | Glucagon (19-29) | 64790-15-4 | Glucagon (19-29) [also known as Miniglucagon; Des(1-18) glucagon] is an endogenous short peptide acting as a regulator of the pancreatic islet physiology. |
![]() |
V38942 | Glucagon HCl | 28270-04-4 | Glucagon HCl is the mono-hydrochloride salt form of glucagon, which is an endogenous peptide hormoneproduced by pancreatic alpha cells. |
![]() |
V30382 | Glucagon receptor antagonists-1 | 503559-84-0 | Glucagon receptor blocker (antagonist)s-1 is a highly active glucagon receptor blocker (antagonist). |
![]() |
V31903 | Glucagon receptor antagonists-2 | 202917-18-8 | Glucagon receptor blocker (antagonist)s-2 is a highly active glucagon receptor blocker (antagonist). |
![]() |
V31904 | Glucagon receptor antagonists-3 | 202917-17-7 | Glucagon receptor blocker (antagonist)s-3 is a highly active glucagon receptor blocker (antagonist). |
![]() |
V74586 | Glucagon receptor antagonists-5 | 2200274-63-9 | Glucagon receptor antagonists-5 (compound 13K) is a potent orally bioavailable glucagon receptor antagonist (Ki=32 nM). |
![]() |
V33988 | Glucagon-Like Peptide (GLP) I (7-36), amide, human | 107444-51-9 | Glucagon-Like Peptide (GLP) I (7-36), amide, human is a novel and potent physiological incretin hormone acting asglucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells. |
![]() |
V76973 | Glucagon-like peptide 1 (1-37), human TFA (HuGLP-1 TFA) | Glucagon-like peptide 1 (1-37), human (TFA) is a potent GLP-1 receptor agonist. | |
![]() |
V76951 | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 polypeptide analogue. | |
![]() |
V74596 | Gulgafafusp alfa | 2642374-02-3 | Gulgafafusp alfa is a human IgG2κ antibody that targets the glucagon-like peptide 1 receptor GLP1R. |
![]() |
V80320 | Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide | Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin-labeled glucagon-like peptide-1-(7-36). | |
![]() |
V16459 | Insulinotropin acetate [GLP-1 (7-37)] | 1450806-98-0 | GLP-1(7-37) acetate [also known as Tglp-1 and Insulinotropin], the acetate salt of GLP-1(7-37), is a novel insulinotropic hormone generated from the precursor peptide GLP-1 (1-37). |