yingweiwo

GCGR

GCGR

The G protein-coupled receptor family, which includes the glucagon receptor (GCGR), is crucial for regulating blood sugar levels. The class B G-protein coupled family of receptors includes the glucagon receptor, a 62 kDa protein that is activated by glucagon and coupled to G alpha i, Gs, and to a lesser extent G alpha q. Adenylate cyclase is activated and intracellular cAMP levels are raised when the receptor is stimulated. The GCGR gene in humans is responsible for encoding the glucagon receptor. The liver and kidneys are the primary sites of glucagon receptor expression, with smaller amounts of these receptors also present in the heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.

GCGR related products

Structure Cat No. Product Name CAS No. Product Description
GLP-1(7-37) V34009 GLP-1(7-37) 106612-94-6 GLP-1(7-37) [also known as Tglp-1 and Insulinotropin] is a novel and potent insulinotropic hormone generated from the precursor peptide GLP-1 (1-37).
GLP-1(9-36)amide TFA V79600 GLP-1(9-36)amide TFA GLP-1(9-36)amide TFA is the major metabolite of glucagon-like peptide-1(7-36)amide.
GLP-1R modulator C16 V74576 GLP-1R modulator C16 875005-43-9 GLP-1R modulator C16 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through the transmembrane site (EC50 8.43 ± 3.82 μM).
GLP-1R modulator C5 V74574 GLP-1R modulator C5 421578-93-0 GLP-1R modulator C5 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through the transmembrane site (EC50 1.59 ± 0.53 μM).
GLP-1R modulator L7-028 V74577 GLP-1R modulator L7-028 2648317-95-5 GLP-1R modulator L7-028 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through a transmembrane site (EC50 11.01 ± 2.73 μM).
GLP-1Ragonist 17 V74590 GLP-1Ragonist 17 2749609-28-5 GLP-1R agonist 17 is a GLP-1 receptor agonist.
GLP-1Ragonist 2 V74567 GLP-1Ragonist 2 281209-71-0 GLP-1R agonist 2 (compound 2) is a potent GLP-1R agonist.
GLP-2(3-33) V74566 GLP-2(3-33) 275801-62-2 GLP-2(3-33) is generated by dipeptidyl peptidase IV (DPPIV) and is a GLP-2 receptor partial agonist (EC50=5.8 nM).
Glucagon (19-29) V16348 Glucagon (19-29) 64790-15-4 Glucagon (19-29) [also known as Miniglucagon; Des(1-18) glucagon] is an endogenous short peptide acting as a regulator of the pancreatic islet physiology.
Glucagon HCl V38942 Glucagon HCl 28270-04-4 Glucagon HCl is the mono-hydrochloride salt form of glucagon, which is an endogenous peptide hormoneproduced by pancreatic alpha cells.
Glucagon receptor antagonists-1 V30382 Glucagon receptor antagonists-1 503559-84-0 Glucagon receptor blocker (antagonist)s-1 is a highly active glucagon receptor blocker (antagonist).
Glucagon receptor antagonists-2 V31903 Glucagon receptor antagonists-2 202917-18-8 Glucagon receptor blocker (antagonist)s-2 is a highly active glucagon receptor blocker (antagonist).
Glucagon receptor antagonists-3 V31904 Glucagon receptor antagonists-3 202917-17-7 Glucagon receptor blocker (antagonist)s-3 is a highly active glucagon receptor blocker (antagonist).
Glucagon receptor antagonists-5 V74586 Glucagon receptor antagonists-5 2200274-63-9 Glucagon receptor antagonists-5 (compound 13K) is a potent orally bioavailable glucagon receptor antagonist (Ki=32 nM).
Glucagon-Like Peptide (GLP) I (7-36), amide, human V33988 Glucagon-Like Peptide (GLP) I (7-36), amide, human 107444-51-9 Glucagon-Like Peptide (GLP) I (7-36), amide, human is a novel and potent physiological incretin hormone acting asglucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells.
Glucagon-like peptide 1 (1-37), human TFA (HuGLP-1 TFA) V76973 Glucagon-like peptide 1 (1-37), human TFA (HuGLP-1 TFA) Glucagon-like peptide 1 (1-37), human (TFA) is a potent GLP-1 receptor agonist.
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS V76951 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 polypeptide analogue.
Gulgafafusp alfa V74596 Gulgafafusp alfa 2642374-02-3 Gulgafafusp alfa is a human IgG2κ antibody that targets the glucagon-like peptide 1 receptor GLP1R.
Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide V80320 Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin-labeled glucagon-like peptide-1-(7-36).
Insulinotropin acetate [GLP-1 (7-37)] V16459 Insulinotropin acetate [GLP-1 (7-37)] 1450806-98-0 GLP-1(7-37) acetate [also known as Tglp-1 and Insulinotropin], the acetate salt of GLP-1(7-37), is a novel insulinotropic hormone generated from the precursor peptide GLP-1 (1-37).
Contact Us