The G protein-coupled receptor family, which includes the glucagon receptor (GCGR), is crucial for regulating blood sugar levels. The class B G-protein coupled family of receptors includes the glucagon receptor, a 62 kDa protein that is activated by glucagon and coupled to G alpha i, Gs, and to a lesser extent G alpha q. Adenylate cyclase is activated and intracellular cAMP levels are raised when the receptor is stimulated. The GCGR gene in humans is responsible for encoding the glucagon receptor. The liver and kidneys are the primary sites of glucagon receptor expression, with smaller amounts of these receptors also present in the heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.
| Structure | Cat No. | Product Name | CAS No. | Product Description |
|---|---|---|---|---|
![[Des-His1,Glu9] Glucagon](http://www.invivochem.com/upload/1124/V74594.png)
|
V74594 | [Des-His1,Glu9] Glucagon | 110121-11-4 | [Des-His1,Glu9] Glucagon is a potent peptide antagonist of the glucagon receptor system. |
![[Des-His1,Glu9]-Glucagon amide TFA](http://www.invivochem.com/upload/1124/V77345.png)
|
V77345 | [Des-His1,Glu9]-Glucagon amide TFA | [Des-His1,Glu9]-Glucagon amide TFA is a potent peptide antagonist of the glucagon receptor with a pA2 value of 7.2. | |
|
V74593 | A8SGLP-1 | 753024-08-7 | A8SGLP-1 is an orally bioactive GLP-1 analog in which alanine at position 8 is replaced by serine. |
|
V77707 | A8SGLP-1 TFA | A8SGLP-1 TFA is an orally bioactive GLP-1 analog in which alanine at position 8 is replaced by serine. | |
|
V93640 | AMG133 peptide payload | The AMG133 peptide payload is a GLP-1 agonist and can be used as a peptide linker conjugate of AMG133. | |
|
V33194 | Avexitide | 133514-43-9 | Avexitide [Exendin-3 (9-39)] is a novel, competitive and peptidic antagonist of glucagon-like peptide-1 (GLP-1) receptor with a Kd of 1.7 nM at cloned human GLP-1 receptors. |
|
V51719 | Bay 55-9837 | 463930-25-8 | VPAC2 agonist |
|
V78347 | Bay 55-9837 TFA | Bay 55-9837 TFA is a potent and selective VPAC2 agonist/activator with a Kd of 0.65 nM. | |
|
V33070 | BETP | 1371569-69-5 | BETP is a novel and potent PAM (positive allosteric modulator) and partial agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50= 0.66 μM) with antidiabetic effects. |
|
V78466 | Biotinyl-Glucagon (1-29), human, bovine, porcine | Biotinyl-Glucagon (1-29), human, bovine, porcine is a biomarker of Glucagon, a peptide hormone produced by pancreatic alpha cells that increases the concentration of glucose and fatty acids in the blood. | |
|
V74587 | Cotadutide (MEDI0382) | 1686108-82-6 | Cotadutide (MEDI0382) is a potent dual glucagon-like peptide-1 (GLP-1) and glucagon receptor (GCGR) agonist/activator with EC50s of 6.9 pM and 10.2 pM, respectively. |
|
V74568 | Dapiglutide (ZP7570) | 2296814-85-0 | Dapiglutide (ZP7570) is a long-acting glucagon-like peptide 1 receptor (GLP-1R)/glucagon-like peptide 2 receptor (GLP-2R) dual agonist. |
|
V79079 | Des His1, Glu8 Exendin-4 | Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. | |
|
V74581 | Elsiglutide (ZP1846) | 914009-84-0 | Elsiglutide (ZP1846) is a GLP-2 analog and an orally bioactive and selective GLP-2 receptor agonist that increases cell proliferation/growth and reduces intestinal cell apoptosis (apoptosis). |
|
V74595 | Exendin (5-39) | 196109-27-0 | Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1 receptor) receptor antagonist. |
|
V74580 | Exendin-3/4 (59-86) | 1263874-37-8 | Exendin-3/4 (59-86) is an Exendin-4 peptide analogue. |
|
V79393 | FC382K10W15 TFA | FC382K10W15 TFA is a glucagon analog and GLP-1R/GCGR agonist. | |
|
V76995 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 polypeptide analogue. | |
|
V74589 | GCGR antagonist 2 | 280134-25-0 | GCGR antagonist 2 is a furan-2-carbohydrazide compound that is an orally bioactive glucagon receptor antagonist. |
|
V74588 | GIP/GLP-1 dual receptor agonist-1 | 2807481-02-1 | GIP/GLP-1 dual receptor agonist-1 (compound 4) is a GIP/GLP-1 dual receptor agonist. |
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
