The G protein-coupled receptor family, which includes the glucagon receptor (GCGR), is crucial for regulating blood sugar levels. The class B G-protein coupled family of receptors includes the glucagon receptor, a 62 kDa protein that is activated by glucagon and coupled to G alpha i, Gs, and to a lesser extent G alpha q. Adenylate cyclase is activated and intracellular cAMP levels are raised when the receptor is stimulated. The GCGR gene in humans is responsible for encoding the glucagon receptor. The liver and kidneys are the primary sites of glucagon receptor expression, with smaller amounts of these receptors also present in the heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.
| Structure | Cat No. | Product Name | CAS No. | Product Description |
|---|---|---|---|---|
|
V28800 | Exendin-4 Acetate | 914454-01-6 | Exenatideacetate (Exendin-4 Acetate), a bioactive peptide composed of 39 amino acids, is antidiabetic medication acting as a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM. |
|
V79393 | FC382K10W15 TFA | FC382K10W15 TFA is a glucagon analog and GLP-1R/GCGR agonist. | |
|
V76995 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 polypeptide analogue. | |
|
V74589 | GCGR antagonist 2 | 280134-25-0 | GCGR antagonist 2 is a furan-2-carbohydrazide compound that is an orally bioactive glucagon receptor antagonist. |
|
V74588 | GIP/GLP-1 dual receptor agonist-1 | 2807481-02-1 | GIP/GLP-1 dual receptor agonist-1 (compound 4) is a GIP/GLP-1 dual receptor agonist. |
|
V74583 | Glepaglutide (ZP1848) | 914009-86-2 | Glepaglutide (ZP1848), a long-acting GLP-2 analog, is a potent GLP-2R agonist. |
|
V76977 | Glepaglutide acetate (ZP1848 acetate) | Glepaglutide (ZP1848) acetate, a long-acting GLP-2 analog, is a potent GLP-2R agonist. | |
|
V79596 | GLP-1 (1-36) amide (human, rat) (TFA) (Glucagon-like Peptide 1 (1-36) amide (human, rat) (TFA)) | GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat) TFA is glucagon-like peptide 1 (GLP-1)-(7-36 ) amide molecular variant. | |
|
V74565 | GLP-1 moiety from Dulaglutide | 1197810-60-8 | GLP-1 moiety from Dulaglutide is a 31-amino acid (AA) fragment derived from Dulaglitude, a glucagon-like peptide 1 receptor (GLP-1) agonist, found in patent US 20160369010 A1. |
|
V31513 | GLP-1 receptor agonist 2 | 2230197-64-3 | GLP-1 receptor agonist (activator) 2 is an agonist of the glucagon-like peptide receptor (GLP-1R). |
|
V74591 | GLP-1 receptor agonist 3 | 2230200-09-4 | GLP-1 receptor agonist 3 (compound (R)-4A-1) is a potent and specific GLP-1 receptor agonist (WO2018109607A1) that may be utilized in diabetes research. |
|
V74592 | GLP-1 receptor agonist 4 | 1187061-62-6 | GLP-1 receptor agonist 4 is a glucagon-like peptide-1 receptor (GLP-1R) agonist/activator with EC50 of 64.5 nM. |
|
V74579 | GLP-1 receptor agonist 7 | 2736447-04-2 | GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 (GLP-1). |
|
V74584 | GLP-1 receptor agonist 8 | 2401892-86-0 | GLP-1 receptor agonist 8 is a potent GLP-1 R agonist. |
|
V74578 | GLP-1 receptor agonist 9 | 2401892-71-3 | GLP-1 receptor agonist (activator) 9 is a GLP-1 receptor agonist (activator), Example 7, developed from WO2020234726 A1. |
|
V74569 | GLP-1(28-36)amide | 1225021-13-5 | GLP-1(28-36)amide is a C-terminal nonapeptide of GLP-1 and is the main product of GLP-1 cleavage by a neutral endopeptidase (NEP). |
|
V79598 | GLP-1(28-36)amide TFA | GLP-1(28-36)amide TFA is a C-terminal nonapeptide of GLP-1 and is the main product of GLP-1 cleavage by a neutral endopeptidase (NEP). | |
|
V74570 | GLP-1(32-36)amide | 1417302-71-6 | GLP-1(32-36)amide, a pentapeptide extracted from the C-terminus of the sugar-regulating hormone GLP-1. |
|
V79599 | GLP-1(32-36)amide TFA | GLP-1(32-36)amide TFA, a pentapeptide extracted from the C-terminus of the sugar-regulating hormone GLP-1. | |
|
V76974 | GLP-1(7-36), amide TFA (Glucagon-like peptide-1 (GLP-1)(7-36), amide TFA; Human GLP-1 (7-36), amide TFA) | GLP-1(7-36), amide TFA is a major intestinal hormone that prompts pancreatic beta cells to secrete insulin when stimulated by glucose. |
Products are for research use only; We do not sell to patients
Copyright 2020 InvivoChem LLC | All Rights Reserved
